ELISA Recombinant Synechococcus sp. Photosystem I assembly protein Ycf4(ycf4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechococcus sp. (strain CC9605) Uniprot NO.:Q3AI50 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAAVLEQPVLGSRRLSNFLVASAVTIGGVGFLLASLSSYLGRDLVPIGHPAALVFVPQG LVMGLYSLAAALLATYLWYVIAVNVGGGSNRFDKDAGVVTISRRGFRKPVLVEIPLKDVK AVKVEVRDGFNARRRVALRIQGRRDMPLTRVGEPLPLAQLEKDGAELARFLGVNLEGL Protein Names:Recommended name: Photosystem I assembly protein Ycf4 Gene Names:Name:ycf4 Ordered Locus Names:Syncc9605_1991 Expression Region:1-178 Sequence Info:fµLl length protein