ELISA Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit e(VMA9)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q3E7B6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSFYTVVGVFIVVSAMSVLFWIMAPKNNQAVWRSTVILTLAMMFLMWAITFLCQLHPLV APRRSDLRPEFAE Protein Names:Recommended name: V-type proton ATPase subunit e Short name= V-ATPase subunit e Alternative name(s): Low dye-binding protein 10 Vacuolar proton pump subunit e Gene Names:Name:VMA9 Synonyms:CWH36, LDB10 Ordered Locus Names:YCL005W-A Expression Region:1-73 Sequence Info:fµLl length protein