Skip to Content

ELISA Recombinant Pseudomonas fluorescens Large-conductance mechanosensitive channel(mscL)

https://www.anagnostics.com/web/image/product.template/151029/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas fluorescens (strain Pf0-1) Uniprot NO.:Q3K6I0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGVLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPIGLLIGGVDFSDLAIT LKAAEGSAPAVVLAYGKFIQSVLDFVIVAFAIFMGVKAINRLKREEAVAPTLPPVPTKEE ELLGEIRDLLKAQNNRP Protein Names:Recommended name: Large-conductance mechanosensitive channel Gene Names:Name:mscL Ordered Locus Names:Pfl01_4887 Expression Region:1-137 Sequence Info:fµLl length protein

1,480.00 € 1480.0 EUR 1,480.00 €

1,480.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.