ELISA Recombinant Thiobacillus denitrificans ATP synthase subunit a(atpB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Thiobacillus denitrificans (strain ATCC 25259) Uniprot NO.:Q3SF60 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATEYASSGEYIKHHLQNLTYGQHADGTWGFAHGAEEAKAMGFWAINVDSmLFSIGLGVL FLFLFRLAAKKATVGVPTGLQNFVEWVIEFIDTSVRGSFSHQNALVAPLALTVFMWVFLM NLMDLLPVDWLPYVATMAGIPYLKVVPSTDPNVTFGLSLSIFFLVLYYSVKMKGAGGFFS ELAFQPFPKFLFPVNLLLEGVGLIAKPISLALRLFGNMYAGEMIFILIALMFGGGWVLAL FGGALQWAWAVFHILIITLQAFIFMTLTIVYLDMAHAEHH Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6 Gene Names:Name:atpB Ordered Locus Names:Tbd_2803 Expression Region:1-280 Sequence Info:fµLl length protein