ELISA Recombinant Xenopus laevis Transmembrane protein 11-B, mitochondrial(tmem11-b)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q3B8H3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATWGRRRAGPGGRERVALAAGECYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPT RIGDETARWISVGNCLHKTAVLSGTACLLTPLALPSEYSHYVSLPAGVLSLACSTLYGIS WQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDMHRKRLHNTIALAALAYCMKK IYELYSV Protein Names:Recommended name: Transmembrane protein 11-B, mitochondrial Gene Names:Name:tmem11-b Synonyms:tmem11 Expression Region:1-187 Sequence Info:fµLl length protein