ELISA Recombinant Rhodobacter sphaeroides ATP synthase subunit b'(atpG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) Uniprot NO.:Q3IZ14 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:METEVHEAAGAAGHAGQAVGMPQLNFDYWPNQIFWLLVTLVAIYFLLTRVALPRIGAVLA ERRGTITNDLAAAEELKQKAVLAEKAYNEALAKARAEAQAIVAETRAAIQAELDEATAKA DAEISAKSAESEARIAEIRAGALQSVSEVAKDTAEALVAALGGKSDAAAVDAAVAARMKG Protein Names:Recommended name: ATP synthase subunit b' Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II F-type ATPase subunit b' Short name= F-ATPase subunit b' Gene Names:Name:atpG Synonyms:atpX Ordered Locus Names:RHOS4_26520 ORF Names:RSP_1036 Expression Region:1-180 Sequence Info:fµLl length protein