ELISA Recombinant Rhodobacter sphaeroides ATP synthase subunit a(atpB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) Uniprot NO.:Q3IZ12 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDQFIVKKLFCHTESTAPMNECTTNIHWYDITNVTMWMAIAVLVIAAILVLGTRRRAIVP SRSQSVAELLYGFIHNMVEEVTGHEGVKYFPYVMTLFLFVLCGNVLGLLPLSFTTTSHMA VTVPLALMVFVGVTALGFMKNGPGFLKMFWVTSAPLAIRPVLAVIEVISYFVRPVSHSIR LAGNMMAGHAVIKVIAGFASIVVVSPVVVGAVTAIYALELLVAVVQAYVFTILTCVYLRD AVGDAHH Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6 Gene Names:Name:atpB Ordered Locus Names:RHOS4_26540 ORF Names:RSP_1038 Expression Region:1-247 Sequence Info:fµLl length protein