ELISA Recombinant Smittium culisetae ATP synthase subunit a(atp6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Smittium cµLisetae (Gut fungus) Uniprot NO.:Q3T4C2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:NPLEQFTVNKIISLYTVYYSMSLTNSSLYFIIAAIISFFIFKYSANIPYVSLINKNNYSI LTESLYKTILKMVKEQIGDKYTIYMPLIFSLFIIILVSNLVGLIPYGFSPTALFALPLGL SVTIIISVTVIGFVKYHLKYFSVLLPSGTPLGLVPLLLVVELLSYIARAFSLGIRLAANI TSGHILLNIISGFLFKTSGIALLFVIIPFTLFIALTGLELIVAILQAYVWSILTCIYIKD SLILH Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase subunit 6 F-ATPase protein 6 Gene Names:Name:atp6 Expression Region:4-248 Sequence Info:fµLl length protein