ELISA Recombinant Xanthomonas campestris pv. vesicatoria UPF0059 membrane protein XCV4291(XCV4291)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xanthomonas campestris pv. vesicatoria (strain 85-10) Uniprot NO.:Q3BMJ1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSPFSIVLIGFAMSTDAFAAAIGKGAAMRKPQWRDALRAGLIFGCIEAITPVIGWLLGRA ASSYVSAYDHWIAFVLLGALGTHMIVAGLRNGPEEAEDAASDTPKRHGVLGLATTGFATS IDAMAVGVSLAFLDVHIGVVAVVVGLCTFSMVTAGVmLGRALGNLIGKRAEmLGGLILVI VGSVILYEHLSGAA Protein Names:Recommended name: UPF0059 membrane protein XCV4291 Gene Names:Ordered Locus Names:XCV4291 Expression Region:1-194 Sequence Info:fµLl length protein