ELISA Recombinant Pseudomonas fluorescens Undecaprenyl-diphosphatase 2(uppP2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas fluorescens (strain Pf0-1) Uniprot NO.:Q3K9J0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDLLTLFKVLILGAVEGLTEFLPISSTGHQIIVADLLEFGGERAMAFNIIIQLGAILAVV WEFRPKIFEIVKGLPTQSNAQRFTRNLLIAFFPAVILGVLFADTIHEYLFNPITVAVALV VGGIVmLWAEQRDHVVSVDHVDDMKWADALKIGCVQCLAMIPGTSRSGSTIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYKYRELFQSSDLPVFALGFVVAFIFAMIAVRGLLKF IANHSYATFAWYRIAFGLLILATWQFGWVNWTAAAAA Protein Names:Recommended name: Undecaprenyl-diphosphatase 2 EC= 3.6.1.27 Alternative name(s): Bacitracin resistance protein 2 Undecaprenyl pyrophosphate phosphatase 2 Gene Names:Name:uppP2 Ordered Locus Names:Pfl01_3826 Expression Region:1-277 Sequence Info:fµLl length protein