Skip to Content

ELISA Recombinant Rhodobacter sphaeroides L-alanine exporter AlaE(alaE)

https://www.anagnostics.com/web/image/product.template/153688/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) Uniprot NO.:Q3IW22 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRLFIIDTVATVIFFTAVATFSELLIAGMAPSEVLATRLLMVPVMVLTGRPYTRWRDWLV RRTAPRNRWSAFLTDILAFLSFQAPVYGATLLIAGASFAEAGTAIGSAIILMILLARPFG LFVEWTRSLFGVELS Protein Names:Recommended name: L-alanine exporter AlaE Gene Names:Name:alaE Ordered Locus Names:RHOS4_36940 ORF Names:RSP_3651 Expression Region:1-135 Sequence Info:fµLl length protein

1,477.00 € 1477.0 EUR 1,477.00 €

1,477.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.