ELISA Recombinant Rhodobacter sphaeroides L-alanine exporter AlaE(alaE)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Uniprot NO.:Q3IW22
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRLFIIDTVATVIFFTAVATFSELLIAGMAPSEVLATRLLMVPVMVLTGRPYTRWRDWLV RRTAPRNRWSAFLTDILAFLSFQAPVYGATLLIAGASFAEAGTAIGSAIILMILLARPFG LFVEWTRSLFGVELS
Protein Names:Recommended name: L-alanine exporter AlaE
Gene Names:Name:alaE Ordered Locus Names:RHOS4_36940 ORF Names:RSP_3651
Expression Region:1-135
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.