ELISA Recombinant Rhodobacter sphaeroides Protease HtpX homolog(htpX)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) Uniprot NO.:Q3J0F7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGYVRTGILMAVMTALFLGVGALIGGQSGAIIALVIAAGMNLFTFWNSDRAVLSMHGAHE VDPRAAPDLYNMVRGLADRAGMPMPKLYLIETDQPNAFATGRNPENAAVAVTRGLLRALT PEEVAGVVAHELAHIRNRDTLLMTVTATFAGAISmLANFAFFFGGSSNEEGERPMGLVGT LALMFLAPLAAGLVQMAISRSREYEADRIGAEICGRPLWLASALGKIEGLAQRIDNVRAE RNPATAHMFIVNPLHAMGHDRLFATHPNTANRIAALRAMAEGAPQASRIPRVAARRGPWS Protein Names:Recommended name: Protease HtpX homolog EC= 3.4.24.- Gene Names:Name:htpX Ordered Locus Names:RHOS4_21590 ORF Names:RSP_0554 Expression Region:1-300 Sequence Info:fµLl length protein