ELISA Recombinant Rhodobacter sphaeroides UPF0060 membrane protein RHOS4_03690(RHOS4_03690)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) Uniprot NO.:Q3J5J7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLSLAAYAGAALAEIAGCFAVWAWWRLGASALWLVPGALSLGTFAWLLALTPVEAAGRS YAVYGGVYVAASLLWLWAVEGVRPDRWDMGGAALVLAGAAVILWAPRG Protein Names:Recommended name: UPF0060 membrane protein RHOS4_03690 Gene Names:Ordered Locus Names:RHOS4_03690 ORF Names:RSP_1789 Expression Region:1-108 Sequence Info:fµLl length protein