ELISA Recombinant Xenopus laevis T-cell leukemia translocation-altered gene protein homolog(tcta)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q3KPU7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAETWVSEIMTQALGCLQAFSSEFALEWESSDMKAAIFKLLLGWIVLSLTAILLAWKSYG PTVNSIYYRQGMGGQNGGTPEYPARFPVWESSSTESLKRHQE Protein Names:Recommended name: T-cell leukemia translocation-altered gene protein homolog Gene Names:Name:tcta Expression Region:1-102 Sequence Info:fµLl length protein