ELISA Recombinant Xenopus laevis Trimeric intracellular cation channel type B-A(tmem38b-a)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q3KQE5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MESLSELSVQFSQLSMFPFFDMAHYVVSVMSAREQAGALDIAARSPMASWFSAmLYCFGG GILSSILLAEPPIAVLSNTTNImLASTIWYMVYYFPYDLFYNCFFFLPIRLIIAGMKEVT RTWKILSGVTHAHSHYKDALLVMITIGWARGAGGGLISNFEQLVRGVWKPESNEFLKMSY PVKVTLIGAVLFTLQHGHYLPISRHNLmLIYTMFLVLIKVTMmLTHSTASPFLPLETPLQ RILFGQRQKPSEVRQSASSSGAKGKPSKKTLDKDSGEQSKKKDS
Protein Names:Recommended name: Trimeric intracellµLar cation channel type B-A Short name= TRIC-B-A Short name= TRICB-A Alternative name(s): Transmembrane protein 38B-A
Gene Names:Name:tmem38b-a
Expression Region:1-284
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.