ELISA Recombinant Xenopus laevis Trimeric intracellular cation channel type B-A(tmem38b-a)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q3KQE5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESLSELSVQFSQLSMFPFFDMAHYVVSVMSAREQAGALDIAARSPMASWFSAmLYCFGG GILSSILLAEPPIAVLSNTTNImLASTIWYMVYYFPYDLFYNCFFFLPIRLIIAGMKEVT RTWKILSGVTHAHSHYKDALLVMITIGWARGAGGGLISNFEQLVRGVWKPESNEFLKMSY PVKVTLIGAVLFTLQHGHYLPISRHNLmLIYTMFLVLIKVTMmLTHSTASPFLPLETPLQ RILFGQRQKPSEVRQSASSSGAKGKPSKKTLDKDSGEQSKKKDS Protein Names:Recommended name: Trimeric intracellµLar cation channel type B-A Short name= TRIC-B-A Short name= TRICB-A Alternative name(s): Transmembrane protein 38B-A Gene Names:Name:tmem38b-a Expression Region:1-284 Sequence Info:fµLl length protein