ELISA Recombinant Shigella sonnei Inner membrane protein CbrB(cbrB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Shigella sonnei (strain Ss046) Uniprot NO.:Q3YWJ8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLLVIIQVLPLFLLLSITTGAIP ALLTGVMVACLPEKIGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSELFENILSGD SLVVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS Protein Names:Recommended name: Inner membrane protein CbrB Gene Names:Name:cbrB Ordered Locus Names:SSON_3560 Expression Region:1-157 Sequence Info:fµLl length protein