ELISA Recombinant Shigella sonnei Protein CysZ(cysZ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Shigella sonnei (strain Ss046) Uniprot NO.:Q3YZC9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSSFTSAPRSGFYYFAQGWKLVSQPGIRRFVILPLLVNILLMGGAFWWLFTQLDVWIPT LMSYVPDWLQWLSYLLWPLAVISVLLVFGYFFSTIANWIAAPFNGLLAEQLEARLTGATP PDTGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLILYFIPGIGQTVAPVLWFLFSAWmLA IQYCDYPFDNHKVPFKEMRTALRTRKITNMQFGALTSLFTMIPLLNLFIMPVAVCGATAM WVDCYRDKHAMWR Protein Names:Recommended name: Protein CysZ Gene Names:Name:cysZ Ordered Locus Names:SSON_2502 Expression Region:1-253 Sequence Info:fµLl length protein