Skip to Content

ELISA Recombinant Solanum tuberosum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3(HMG3)

https://www.anagnostics.com/web/image/product.template/157596/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Solanum tuberosum (Potato) Uniprot NO.:Q41438 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDVRRRPVKPLYPSEHISSGEPLKPHNQDSSVKASDALPLPLYLTNGLFFTMFFSVMYFL LHRWREKIRNGIPLHVLNFSELVAMVSLIASVIYLLGFFGIGFVQSFVSKGNNDSWDVED ESPEQFIDRTVTPPPVRRNIPMKSVPVAEKTAQIITPFSSEDDEVVIKSVVEGRIPSYSL ESKLGDCKRAAFIRKEALQRSSGKSLEGLPLDGFDYESILGQCCEMPIGYIQIPVGIAGP LLLNGKEFSVPMATTEGCLVASTNRGCKAIYVSGGATSVLFRDAMTRAPVVRFGSAKRAA ELKFFVEDPMNFETLSVVFNKSSRFARLQNIQCAIAGKNLYMRFSCSTGDAMGMNMVSKG VQNVLDYLQNEYPDMDIIGISGNYCSDKKPAAVNWIEGRGKSVVCEAIIKEDVVKKVLKT EVATLVELNmLKNLTGSAMAGALGGFNAHASNIVSAVYLATGQDPAQNIESSHCITMMEA VNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLGVKGANREAPGSNARLLATIVAG SVLAGELSLMSAISAGQLVKSHMKYNRSCKDVTK Protein Names:Recommended name: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 Short name= HMG-CoA reductase 3 EC= 1.1.1.34 Alternative name(s): HMG3.3 Gene Names:Name:HMG3 Expression Region:1-574 Sequence Info:fµLl length protein

1,941.00 € 1941.0 EUR 1,941.00 €

1,941.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.