ELISA Recombinant Pseudomonas syringae pv. phaseolicola NADH-quinone oxidoreductase subunit K(nuoK)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) Uniprot NO.:Q48H45 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNAIPLEHGLAVAGVLFCLGLVGLMVRRNILFVLMSLEIMMNASALAFVVAGSRWAQPDG QVMFILVISLAAAEASIGLAILMQLYRRFHTLDIDAASEMRG Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K Gene Names:Name:nuoK Ordered Locus Names:PSPPH_3118 Expression Region:1-102 Sequence Info:fµLl length protein