ELISA Recombinant Pseudomonas syringae pv. phaseolicola Glycerol-3-phosphate acyltransferase(plsY)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) Uniprot NO.:Q48NU7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSMFWLLATFAYLLGSLSFAILLSRLSGRPDPRASGSGNAGATNmLRLAGKKLAILTLL GDLCKGLLPILIASAWNLNIAQQGWIGVCAVLGHLFPVYFRFRGGKGVATAAGVLLGLYP PAAALAIAAWLLTLYLTRTSSLAALIATPLTLPLLAWQEPHALLPMSVLTLLIVWRHRGN LRDLLAGRERHF Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati Gene Names:Name:plsY Ordered Locus Names:PSPPH_0623 Expression Region:1-192 Sequence Info:fµLl length protein