ELISA Recombinant Staphylococcus saprophyticus subsp. saprophyticus Sensor histidine kinase graS(graS)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) Uniprot NO.:Q49VK4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANLKWFFIFLRSRIYWILWLLFLHFIFLGIAYLDYDISVYSILYIIILNIGLSVLFLIF TYLKEVKFYKHLDENIEPEALKHKSLADTPFQQEMVNYLYGQITNQKALVTHQKQQIQST EAALTDFVHDIKTPVTAMKLLIEKEQDLSRKHALLYEWSRINDmLDRQLFLTRLEYQNKD MYFEHVPLKRLVIEEIQITRYISQSKGIGYDLDFEDTLNVYTDTKWCRMMIRQVLSNAVK YSEESMIHIRALKESRHVVLEIKDEGKGISEKDLPRIFDKGFTSTSNRNNTISSGLGLYL VNHVKEKLSICVRIHSELDKGTVVKFIFPNQNEIVAKLSQNI Protein Names:Recommended name: Sensor histidine kinase graS EC= 2.7.13.3 Alternative name(s): Glycopeptide resistance-associated protein S Gene Names:Name:graS Ordered Locus Names:SSP2061 Expression Region:1-342 Sequence Info:fµLl length protein