ELISA Recombinant Spinacia oleracea Photosystem I reaction center subunit XI, chloroplastic(PSAL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Spinacia oleracea (Spinach) Uniprot NO.:Q41385 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AIKTEKPTYQVIQPLNGDPFIGGLETPVTSSPLIAWYLSNLPAYRTAVNPLLRGVEVGLA HGFLLVGPFVKAGPLRNTEYAGAAGSLAAAGLVVILSMCLTMYGIASFKEGEPSIAPALT LTGRKKQPDQLQSADGWAKFTGGFFFGGVSGVTWACFLMYVLDLPYYFK Protein Names:Recommended name: Photosystem I reaction center subunit XI, chloroplastic Short name= PSI-L Alternative name(s): PSI subunit V Gene Names:Name:PSAL Expression Region:48-216 Sequence Info:fµLl length protein