ELISA Recombinant Staphylococcus saprophyticus subsp. saprophyticus Monofunctional glycosyltransferase(mgt)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Uniprot NO.:Q49YR9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKRSDRYKTYNKPNDSNDSNQLHHNTYFKPVNKPQKKKKGKGIILKLLIPILIIIGIIIG VMYALSLRADTDELKNITEKESFVYASDMRDYTKGAFIAMEDERFYKHHGFDVKGTSRAL FSTLSDKSVQGGSTITQQVVKNYYYDNEQSITRKIKELFVAHRVEKEYDKNEILSFYMNN IYYGSDQYTIESAANHYFGVTTDKNNPNLPQISVLQSAILASKINAPSVYNINDMSDNFT NRVKTDLEKMKQQGYISNSQYENAIQELGV
Protein Names:Recommended name: Monofunctional glycosyltransferase Short name= MGT EC= 2.4.-.- Alternative name(s): Peptidoglycan TGase
Gene Names:Name:mgt Ordered Locus Names:SSP0919
Expression Region:1-270
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.