ELISA Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0382 membrane protein SSP2132(SSP2132)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Uniprot NO.:Q49VD3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKVFIILGALNAMMAVGTGAFGAHGLENKLSAKYLSVWEKATTYQMYHGLGLLAIGIISG TTSINVNWVGWLLFFGIVFFSGSLYILALTQIRIIGAITPIGGVLFIVGWLmLVIGTFKI
Protein Names:Recommended name: UPF0382 membrane protein SSP2132
Gene Names:Ordered Locus Names:SSP2132
Expression Region:1-120
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.