ELISA Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0382 membrane protein SSP2132(SSP2132)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) Uniprot NO.:Q49VD3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKVFIILGALNAMMAVGTGAFGAHGLENKLSAKYLSVWEKATTYQMYHGLGLLAIGIISG TTSINVNWVGWLLFFGIVFFSGSLYILALTQIRIIGAITPIGGVLFIVGWLmLVIGTFKI Protein Names:Recommended name: UPF0382 membrane protein SSP2132 Gene Names:Ordered Locus Names:SSP2132 Expression Region:1-120 Sequence Info:fµLl length protein