ELISA Recombinant Staphylococcus saprophyticus subsp. saprophyticus Na(+)-H(+) antiporter subunit E1(mnhE1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) Uniprot NO.:Q49W87 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAIQILVNLILSVFWLFVTGSYNFNNFILGYLFALLLVYIMRGVLPGRFYLITVYKIIKL FLVFLIELIKANIDVIRIVVKPNIDNEPAFFTYNTDLKKDWQIVLLSNLITLTPGTIVLG ISDDRTKIYIHSIDFSTKEEEVESIKSSLEKVVREVGENE Protein Names:Recommended name: Na(+)/H(+) antiporter subunit E1 Alternative name(s): Mnh complex subunit E1 Gene Names:Name:mnhE1 Ordered Locus Names:SSP1827 Expression Region:1-160 Sequence Info:fµLl length protein