ELISA Recombinant Prochlorococcus marinus PsbF-like protein(PMN2A_0792)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Prochlorococcus marinus (strain NATL2A) Uniprot NO.:Q46JP5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MINLKLLLVLTPVIFSVAFTDYWLRRWGVFVWDNGPTIQNQQVWEDTAIVADKGRPSDGY PVFTVRTLAVNALGIPSVFFLGAIFAMQFIRRGVINA Protein Names:Recommended name: PsbF-like protein Gene Names:Ordered Locus Names:PMN2A_0792 Expression Region:1-97 Sequence Info:fµLl length protein