ELISA Recombinant Pseudomonas syringae pv. phaseolicola Disulfide bond formation protein B 2(dsbB2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) Uniprot NO.:Q48QE1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYLARTRFLFFLASLACASIIGTAFYLQQTFGLDPCFLCLIQRAAIIACGVLALCAACHA PGPTGMRRYSLGFLLIALTGLVTAGAQVWLQTASADQLIPFITKLEHLLSLLSLDMCIDR LRSDAMFCAEITWTLFGISLPEWSLLAFTGLALLPLYPLFSEFSHWLATKDRARY Protein Names:Recommended name: DisµLfide bond formation protein B 2 Alternative name(s): DisµLfide oxidoreductase 2 Gene Names:Name:dsbB2 Ordered Locus Names:PSPPH_0063 Expression Region:1-175 Sequence Info:fµLl length protein