ELISA Recombinant Staphylococcus saprophyticus subsp. saprophyticus UPF0316 protein SSP0880(SSP0880)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) Uniprot NO.:Q49YV5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVITSNPWLMVLAIFIINVAYVTCLTMRTILTLKGYRYVAAIVSFLEVLVYVVGLGMVM SSLDQIQNVFAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSSEYELDLPRQLRDLGYGVT HNTAYGRDGKRLILQILTPRRFEFKLIDTIKQIDEKAFIVAYEPRQIHGGFWAKGVRSKK LKQYDTDEVESI Protein Names:Recommended name: UPF0316 protein SSP0880 Gene Names:Ordered Locus Names:SSP0880 Expression Region:1-192 Sequence Info:fµLl length protein