ELISA Recombinant Staphylococcus saprophyticus subsp. saprophyticus Accessory gene regulator protein B(agrB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) Uniprot NO.:Q49YZ1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVKFIDAKIDNFAKQLQQRNNLDRIEYLKMRLGMQVVVNNFFKTIVIYGVSLLCHMFLYT LTVHLTFFFIRHFAHGAHAKNSLLCYIQSVIYFVLLPWIVGYVQVSSLIMYTLALVGLII ISIYAPSATKKQPIPERLRRGKKIKAICLTLIFLLISLFLNEPYQQLmLLGIVIISILQF PIFFPKEDY Protein Names:Recommended name: Accessory gene regµLator protein B EC= 3.4.-.- Gene Names:Name:agrB Ordered Locus Names:SSP0842 Expression Region:1-189 Sequence Info:fµLl length protein