ELISA Recombinant Staphylococcus saprophyticus subsp. saprophyticus Membrane protein insertase YidC(yidC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) Uniprot NO.:Q49Z38 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CDYSKPENRDGFFYNTFYVPMDNVIHWLGTSFNNDYGLAIVVLVLVIRIVLLPFmLSNYK NSHMMREKMKVAKPDIDAIQEKVKRSRTQEEKMAANSEMMEVYKKYDMNPMKSmLGCLPI LIQMPIIMGLFFVLKYPSSGGFTEHPYFLWFNLAKPDIWITIIAGILYFLQAYVSSKSMP AEQRQMGYMMMVISPIMIVWISFSSVSALGLYWSVSAAFLIVQTQVANMYYSKLAQREVA PMIEAMEKNKAEASGKGKNTQVVSKKNKKK Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC Gene Names:Name:yidC Ordered Locus Names:SSP0793 Expression Region:20-289 Sequence Info:fµLl length protein