ELISA Recombinant Xenopus laevis Heme transporter hrg1-B(slc48a1-b)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q4FZW7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAVTKQLWIRIIYAAVGTLFGLSAFLVWNVAFVQPWTAAMGGLSGVLALWALITHIMYVQ DFWRTWLKGLRFFLCIGVLFFVLALVAFITFLAVAISEKQSISDPKSLYLSCVWSFMSMK WAFLLSLYSYRYRKEFADISILSDF Protein Names:Recommended name: Heme transporter hrg1-B Alternative name(s): Heme-responsive gene 1 protein homolog B Short name= HRG-1B Solute carrier family 48 member 1-B Gene Names:Name:slc48a1-b Synonyms:hrg1-b Expression Region:1-145 Sequence Info:fµLl length protein