ELISA Recombinant Pseudomonas syringae pv. phaseolicola UPF0059 membrane protein PSPPH_3559(PSPPH_3559)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) Uniprot NO.:Q48FX8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNPISLLFLALAMSTDAFAAALGKGASLHKPRFIEALRTGLIFGAIETITPVIGWGIGQV AARFAESWDHWIAFTLLLVLGLHMIYNGIKHDDDEEQEKPGQHSFWILAVTAFATSIDAL AVGVGLAFVDVNIVIAALAIGLATTVMVTIGVmLGRVLGTMVGKRAEIVGGIVLIIVGAT ILYEHLSAA Protein Names:Recommended name: UPF0059 membrane protein PSPPH_3559 Gene Names:Ordered Locus Names:PSPPH_3559 Expression Region:1-189 Sequence Info:fµLl length protein