ELISA Recombinant Psychrobacter arcticus UPF0059 membrane protein Psyc_0005(Psyc_0005)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Psychrobacter arcticus (strain DSM 17307 / 273-4) Uniprot NO.:Q4FVS9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDIEMIEVILLAIALAMDAFAVSIGLGAKSQKQSSAYVLRLAVYAALYFGIAQGVMPLIG YLLGAVLLGWLATAAPWIGGGILIVLGAKmLYEAFNGEIEAVLEDGFDENIRKKINHRMM FTLAIATSIDAMAAGFTLNLLALNAWLACLIIAIVTAGFGFFGIYLGKSSGTWLEDKAEI LGGLVLIAIGVKVmLFS Protein Names:Recommended name: UPF0059 membrane protein Psyc_0005 Gene Names:Ordered Locus Names:Psyc_0005 Expression Region:1-197 Sequence Info:fµLl length protein