ELISA Recombinant Rat Signal recognition particle receptor subunit beta(Srprb)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q4FZX7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVAVLAVLLTLVFWKFIWSRKS SQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHE SLRLQFLDRFKSSARAVVFVVDSATFQREVKDVAEFLYQVLIDSMALKNTPAFLVACNKQ DIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVE FLECSAKGGRGDAGSADVQDLEKWLAKIA Protein Names:Recommended name: Signal recognition particle receptor subunit beta Short name= SR-beta Gene Names:Name:Srprb Expression Region:1-269 Sequence Info:fµLl length protein