ELISA Recombinant Varicella-zoster virus Glycoprotein K(gK)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Varicella-zoster virus (strain Oka vaccine) (HHV-3) ( herpesvirus 3) Uniprot NO.:Q4JQX0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:VFTLWYTARVKFEHECVYATTVINGGPVVWGSYNNSLIYVTFVNHSTFLDGLSGYDYSCR ENLLSGDTMVKTAISTPLHDKIRIVLGTRNCHAYFWCVQLKMIFFAWFVYGMYLQFRRIR RMFGPFRSSCELISPTSYSLNYVTRVISNILLGYPYTKLARLLCDVSMRRDGMSKVFNAD PISFLYMHKGVTLLmLLEVIAHISSGCIVLLTLGVAYTPCALLYPTYIRILAWVVVCTLA IVELISYVRPKPTKDNHLNHINTGGIRGICTTCCATVMSGLAIKCFYIVIFAIAVVIFMH YEQRVQVSLFGESENSQKH Protein Names:Recommended name: Glycoprotein K Short name= gK Alternative name(s): Syncytial protein Gene Names:Name:gK ORF Names:ORF5 Expression Region:22-340 Sequence Info:fµLl length protein