ELISA Recombinant Sulfolobus acidocaldarius Protease HtpX homolog 2(htpX2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:SµLfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) Uniprot NO.:Q4JBJ9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVLSAISVIILGFLVAYGLLGYLFGFAYTSIIVTGALAFVTFFTIIQWLLGPLMIKAAYR LIEVKADDPTYGWVYNLVQEVATYNNMSMPKVYVAPVNFPNAFAFSSPLFGKNMAITTPL INILNKDEIKAVIGHEIGHLRHRDTEILLAVSLIPTLMYWLGYSLWWGGLLGGGGGGRNS NSGLLFLIGIVLIAVSFVFNIFVLFLNRMREAYADVNSALTIPNGASNLQTALAKIVIYT DPGIVDRVKQKSGGVAKmLLFSGTDVSNEEIPSYKAQELVNYWRTQKVGILSDLFSDHPH PAKRIKLLDKFTQAQWSPVA Protein Names:Recommended name: Protease HtpX homolog 2 EC= 3.4.24.- Gene Names:Name:htpX2 Ordered Locus Names:Saci_0415 Expression Region:1-320 Sequence Info:fµLl length protein