ELISA Recombinant Pseudomonas fluorescens Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE(arnE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) Uniprot NO.:Q4KC79 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLLLLLLACGLTCLGQVAQKFAVESWRGQPSSALQKLRSGWLWLALFSLGLGLLVWLLV LQRMEVGVAYPmLSLNFVFITLIAHFVFREHIDRRHWFGVALVIGGVLLLSRHA Protein Names:Recommended name: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE Short name= L-Ara4N-phosphoundecaprenol flippase subunit ArnE Alternative name(s): Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE Gene Names:Name:arnE Ordered Locus Names:PFL_3048 Expression Region:1-114 Sequence Info:fµLl length protein