ELISA Recombinant Staphylococcus haemolyticus Na(+)-H(+) antiporter subunit B1(mnhB1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus haemolyticus (strain JCSC1435) Uniprot NO.:Q4L4W6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNRQNNNLMFQYAAVIIAFLIALFGVTLFFAGHYTPGGGFVGGLLLSCALTIIAIAFDIK TMEKVFPWDFKILIGIGLLFCVATPLASWFYGENFFTHTEFNIPLPLLQPVHMNTPMFFD FGVLCAVVGTIMTIIITIGESE Protein Names:Recommended name: Na(+)/H(+) antiporter subunit B1 Alternative name(s): Mnh complex subunit B1 Gene Names:Name:mnhB1 Ordered Locus Names:SH2000 Expression Region:1-142 Sequence Info:fµLl length protein