ELISA Recombinant Staphylococcus haemolyticus Probable quinol oxidase subunit 3(qoxC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus haemolyticus (strain JCSC1435) Uniprot NO.:Q4L563 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSHDTNTVDSRTHEGQLNKLGFWIFLTAEFSLFGTLFATLLTLQHGGDYAGKMTTELFEL PLVLIMTFALLISSYTCGISIYYMRKEKQNLMMFWMILTVLLGLVFVGFEIYEFAHYVSE GVTPQIGSYWSSFFILLGTHGAHVSLGIGWIICLLIQVATRGLNKYNAPKLFIVSLYWHF LDVVWIFIFTAVYMIGMVYSG Protein Names:Recommended name: Probable quinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Quinol oxidase polypeptide III Gene Names:Name:qoxC Ordered Locus Names:SH1903 Expression Region:1-201 Sequence Info:fµLl length protein