ELISA Recombinant Xenopus laevis Probable E3 ubiquitin-protein ligase RNF217(rnf217)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q4KLT0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSCRVCLEDRSIKPLPCCKKPVCDECLKRYLSSQVQLGQAEIQCPITECNKHLDESTILY SLPHDDIIKYKYFLELSRMDSSTKPCPQCKHFTTFKRKTHIPNPTKSENKLKIQCPSCQF IWCFRCHAPWHEGVNCREYKKGDKLLRHWANEIEHGQRNAQKCPRCKVHIQRTEGCDHMT CSQCNTNFCYRCGERYRQLRFFGDHTSNLSIFGCKYRYLPERPHVRRLVRGSVCAGKLLI APLLIVLGLVLGALAVVIGLFGLPIYCLCKKQRKRTRTGMPW Protein Names:Recommended name: Probable E3 ubiquitin-protein ligase RNF217 EC= 6.3.2.- Alternative name(s): RING finger protein 217 Gene Names:Name:rnf217 Expression Region:1-282 Sequence Info:fµLl length protein