ELISA Recombinant Staphylococcus haemolyticus UPF0382 membrane protein SH2409(SH2409)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus haemolyticus (strain JCSC1435) Uniprot NO.:Q4L3Q9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKLFIILGALCTMMSVGTGAFGAHGLEGKLSDKYMSVWEKAVNYQMYHGLGLIIIGVISG TTSINVNWAGWLLFLGVVFFSGSLYILALTQIRILGAITPIGGLLFIAGWLmLIISTFKF VG Protein Names:Recommended name: UPF0382 membrane protein SH2409 Gene Names:Ordered Locus Names:SH2409 Expression Region:1-122 Sequence Info:fµLl length protein