ELISA Recombinant Staphylococcus haemolyticus Probable protein-export membrane protein SecG(secG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus haemolyticus (strain JCSC1435) Uniprot NO.:Q4L4K9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHTLFIVLLIIDCIALITVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTII LAVIFFLIMIGISYFGL Protein Names:Recommended name: Probable protein-export membrane protein SecG Gene Names:Name:secG Ordered Locus Names:SH2107 Expression Region:1-77 Sequence Info:fµLl length protein