Skip to Content

ELISA Recombinant Staphylococcus haemolyticus Phosphatidate cytidylyltransferase(cdsA)

https://www.anagnostics.com/web/image/product.template/158808/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus haemolyticus (strain JCSC1435) Uniprot NO.:Q4L5W3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKVRTLTAIIALLIFLPILLMGGTTLmLFAYLLALIALKELLNMNMIKLISVPGIFSALA LIIImLPQSAGDWVSNIQLKSLIAMSFILLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM YFYATRSDGLHYILYAFLVVWLTDTGAYIFGRLMGKHKLWPVISPNKTIEGFIGGLICSL IVPIVmLFFVDFNLNIWLLLLVTIILSIFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL DRFDSFMFVLPLLNILLIQM Protein Names:Recommended name: Phosphatidate cytidylyltransferase EC= 2.7.7.41 Alternative name(s): CDP-DAG synthase CDP-DG synthase CDP-diacylglycerol synthase Short name= CDS CDP-diglyceride pyrophosphorylase CDP-diglyceride syn Gene Names:Name:cdsA Ordered Locus Names:SH1653 Expression Region:1-260 Sequence Info:fµLl length protein

1,609.00 € 1609.0 EUR 1,609.00 €

1,609.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.