Skip to Content

ELISA Recombinant Staphylococcus haemolyticus Probable CtpA-like serine protease(SH1486)

https://www.anagnostics.com/web/image/product.template/158810/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus haemolyticus (strain JCSC1435) Uniprot NO.:Q4L6D0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRKCFFMSHNPEEKQSNLDSNHKNESSSNKRIKFKTWQFILLLLGVVIITAGITVAATIG ISHKISGLTKDERQEIKKIEYAYKTLNNDYYKKQNAGKLSEAAIDGMVKELKDPYSEYMT KDETKSFNEDVSGDFVGIGAEMQKKDKQIMITSPMKDSPAEKAGIQPKDVVTKVDGKSVV GKPLDQVVKLVRGKEGTTVKLTIKRGSQEKEIKIKRGKIHVKSVEYKKKDNIGVFTINKF QDNTAGELKSAIIKAHKDGVRSIVLDLRNNPGGLLDEAVKMANIFIDKDQTVVKLEKGDD TESIKTSNDASNEAKDMKVSILVNEGSASASEVFTGAMRDHKKAKVYGSKTFGKGIVQTT REFKDGSLLKYTQMKWLTPDGHNIHGKGIQPDTKIASPQYQSISVIPTDKSYSVGDNTKY VKSIKIGLDALGYNVNNDSKQFDTQLESAIKKFQSEHELSVNGKFDKKTNEKFTQLLVEK ANKEDKVLDELINKLK Protein Names:Recommended name: Probable CtpA-like serine protease EC= 3.4.21.- Gene Names:Ordered Locus Names:SH1486 Expression Region:1-496 Sequence Info:fµLl length protein

1,859.00 € 1859.0 EUR 1,859.00 €

1,859.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.