ELISA Recombinant Staphylococcus haemolyticus UPF0316 protein SH1041(SH1041)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus haemolyticus (strain JCSC1435) Uniprot NO.:Q4L7M5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVITSNPWSMVLAIFVINVFYVTFLTMRTILTLKGYRYMAAAVSFLEVLVYVVGLGMVM SSLDQIQNIFAYAFGFSIGILVGMKIEEKLALGYTVVNVTSSEYEIDLPNELRNLGYGVT HYAAHGRDGSRMVMQILTPRRYERKLMETVRNLDEKAFIIAYEPRAIHGGFWTKGVRTRK VKAYEVEEIESVVEHDDEVQSK Protein Names:Recommended name: UPF0316 protein SH1041 Gene Names:Ordered Locus Names:SH1041 Expression Region:1-202 Sequence Info:fµLl length protein