ELISA Recombinant Staphylococcus haemolyticus Monofunctional glycosyltransferase(mgt)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus haemolyticus (strain JCSC1435) Uniprot NO.:Q4L7I0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKRSQRMNNSPERHSQYRNEPHYNTYYQPVGKPPKKKKNKRIFLRLFIIFVFIYALFIGL MYYLSSRANVDDLKTIENKSSYVSADNMPDYVKGAFISMEDERFYKHHGFDVKGTTRALF STIGDRDVQGGSTITQQTVKNYYYDNERSFTRKLKELFVAHKVEQQYSKNEILSFYLNNI YYGSDQYTIESAANYYFGTTVNKNSDSMSQITVLQSAILASKVNAPSVYDISNMSDNFKN RIKTNLEKMKQQEYISDSQYQEALSQLNNY Protein Names:Recommended name: Monofunctional glycosyltransferase Short name= MGT EC= 2.4.-.- Alternative name(s): Peptidoglycan TGase Gene Names:Name:mgt Ordered Locus Names:SH1086 Expression Region:1-270 Sequence Info:fµLl length protein