ELISA Recombinant Staphylococcus haemolyticus Membrane protein insertase YidC(yidC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus haemolyticus (strain JCSC1435) Uniprot NO.:Q4L7X2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CDYSKSSNRDGFFYNTFVEPMSKVLHWLGHSVFNDDYGIAIIVLVLVIRIILLPFmLSNY KNSHLMREKMKVAKPEVDGVQEKVKRARTQEEKMAANQEMMEVYKKYDINPMKSALGCLP VLIQMPVVMGLYFVLRYRIGGGIAEHPHFLWFNLIHPDIWITIIAGVLYFIQAWVSSKQM PQEQRQMTYMMMIVSPIMIIWISLSSASALGLYWSVSAAFLVVQTYFANMYYEKVAQREV APMIEKFKENNSNSNKKGKNTQVVSKNNKKKK Protein Names:Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC Gene Names:Name:yidC Ordered Locus Names:SH0944 Expression Region:20-291 Sequence Info:fµLl length protein