ELISA Recombinant Xenopus laevis Transmembrane protein 150B-B(tmem150b-b)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q4V7T3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVSNGSVNLSDGFPYISVSGTYPPQSCVFGQVLNVGAmLAVWISVIRFQQIRDYNCHSV LNSVSLATGILCALGTSIVGNFQQSNQLQTHLAGAFLAFIIGNVYFWMQTALTYMVKPKH GGCYIGPIRFCLSIACTALIVAMAVFLKMNMKSVSAICEWIVAMILFLLYGLFAVDFWHL DGHFFHVKKRRTVIPNEMEVSTVTLSI Protein Names:Recommended name: Transmembrane protein 150B-B Alternative name(s): Transmembrane protein 224-B Gene Names:Name:tmem150b-b Synonyms:tmem224-b Expression Region:25-231 Sequence Info:fµLl length protein