ELISA Recombinant Rat Uroplakin-1b(Upk1b)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q566D0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AKDDSTVRCFQGLLIFGHVIVGMCGIALTAECIFFVSDQHSLYPLLEATNNDDIFGAAWI GMFVGICLFCLSVLAIVGIMKSNRKILLAYFIMMFIVYGFEVASCITAATQRDFFTTNLF LKQmLMRYQNNSPPTNDDKWKNSYVTKTWDRLmLQDHCCGVNGPSDWQKYTSAFRVENSD ADYPWPRQCCVMDKLQEPLNLDACKLGVPGYYHSQGCYELISGPMDRHAWGVAWFGFAIL CWTFWVLLGTMFYWSRIEY Protein Names:Recommended name: Uroplakin-1b Short name= UP1b Alternative name(s): Uroplakin Ib Short name= UPIb Gene Names:Name:Upk1b Expression Region:2-260 Sequence Info:fµLl length protein