ELISA Recombinant Xenopus laevis Calcium release-activated calcium channel protein 1(orai1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q5EAU0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYPECGVETKSRPCSKQLQEEVSYPEWISRSYVELMSLNEHSMQALSWRKLYLSRAKLKA SSRTSALLSGFAMVAMVEVQLEPNHAYPPGLLIAFSACTTVLVAVHLFALMVSTCILPNI EAVSNVHNLNSVKESPHERMHHHIELAWAFSTVIGTLLFLAEVVLLCWVKFLPVNSPKIS SNETSAVSSGQAAAITSTAIMVPFGLVFIVFAVHFYRSLVSHKTDRQFQELNELAELAQL QDQLDHRGDPVQSPVHYA Protein Names:Recommended name: Calcium release-activated calcium channel protein 1 Alternative name(s): Protein orai-1 Transmembrane protein 142A Gene Names:Name:orai1 Synonyms:tmem142a Expression Region:1-258 Sequence Info:fµLl length protein